DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG5246

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:293 Identity:83/293 - (28%)
Similarity:129/293 - (44%) Gaps:55/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CLVLQEQVAANFLIPSCGVS-------YESN-------VATRIVRGKEAMLKSAPFMAYLYYSSE 67
            ||||   ::...::..|...       ::.|       ..||::.|.::....||:...:..:..
  Fly     3 CLVL---ISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFG 64

  Fly    68 IH-CGGTIISSRYILTAAHCMR---PYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKR 128
            .| |||:||:.::||||||||.   .|||:..|..|.||           |..|:.:..:..:..
  Fly    65 EHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTR-----------PGAEYLVDGSKIHCS 118

  Fly   129 FDR-FLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNV-HEFQAFGWGQTET-NHSANVLQTT 190
            .|: ...|||||:..::.|.::...|||.| .:..:.|.| .:....|||.|:| ...:..||..
  Fly   119 HDKPAYHNDIALIHTAKPIVYDDLTQPIKL-ASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKI 182

  Fly   191 VLTRYDNRHCRSVLSMPITINQLCVGF------QGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIV 249
            .|...|:.:|:|.:.   ..|.|..|.      :|..:|.||||||||..       ....:|:|
  Fly   183 DLNYIDHDNCQSRVR---NANWLSEGHVCTFTQEGEGSCHGDSGGPLVDA-------NQTLVGVV 237

  Fly   250 SFGDDKCQ--SPGVYTYVPNYIRWIRYVMQSNG 280
            ::| :.|.  .|.|:..|..|..||..:|...|
  Fly   238 NWG-EACAIGYPDVFGSVAYYHDWIEQMMTDAG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 72/242 (30%)
Tryp_SPc 45..273 CDD:238113 72/242 (30%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 72/242 (30%)
Tryp_SPc 42..263 CDD:238113 73/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.