DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG17475

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:293 Identity:85/293 - (29%)
Similarity:127/293 - (43%) Gaps:64/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IYICMCVC--------LVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYL--YY 64
            :.:..|.|        |....:....::..:.||::::    |::.|::..|..|.:...|  .|
  Fly    11 VILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQN----RVINGEDVQLGEAKYQISLQGMY 71

  Fly    65 SSEIHCGGTIISSRYILTAAHCM---RP-YLKVRLGEHDITRNPDCQGGSCSPPAEEF--DIVLA 123
            ...| |||.||..|::||||||:   .| ||:|..|..:..:          |.|..|  :..:.
  Fly    72 GGHI-CGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEK----------PDAVYFVEEHWIH 125

  Fly   124 TKYKRFDRFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAFGWGQTET-NHSANVL 187
            ..|...|  ..|||||::|:..|:||.:.||..|...|.|  |..:....|||.||. ..:.::|
  Fly   126 CNYNSPD--YHNDIALIRLNDTIKFNEYTQPAELPTAPVA--NGTQLLLTGWGSTELWGDTPDIL 186

  Fly   188 QTTVLTRYDNRHCRSVLSM-----PITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGV------W 241
            |...||......|:.:::.     |..|..|..|.||:  |.|||||||    .::||      |
  Fly   187 QKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGA--CHGDSGGPL----THNGVLYGLVNW 245

  Fly   242 RY-LQLGIVSFGDDKCQSPGVYTYVPNYIRWIR 273
            .| ..||:          |..:..|..|:.|||
  Fly   246 GYPCALGV----------PDSHANVYYYLEWIR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 77/248 (31%)
Tryp_SPc 45..273 CDD:238113 77/248 (31%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 77/248 (31%)
Tryp_SPc 50..269 CDD:238113 79/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437325
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.