DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and ea

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:300 Identity:97/300 - (32%)
Similarity:149/300 - (49%) Gaps:60/300 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VAANFLIP---SCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSE-----IHCGGTIISSRYI 80
            |.:|.|:|   .||    :.::.||..|.:..:...|:||.:.|:..     .||||::||:||:
  Fly   108 VTSNSLLPLPGQCG----NILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYV 168

  Fly    81 LTAAHCMR--------PYLKVRLGEHDITRNPDCQGG-----SCSPPAEEF---------DIVLA 123
            :||:||:.        ....|||||.|...||||:..     .|:||..:.         |.:.|
  Fly   169 ITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPA 233

  Fly   124 TKYKRFDRFLANDIALLKLSRNIRFNVHIQPICLILN---PAAAPNVHEFQAFGWGQTETNHSAN 185
            :|.:      .||||||:|::.:.:...::||||.|:   .:|..:.......|||:||...::|
  Fly   234 SKNQ------VNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQLSASN 292

  Fly   186 VLQTTVLTRYDNRHCRSVLS---MPITINQLCV-GFQGSDTCSGDSGGPLV----TKVN-YDGVW 241
            :.....:..:....|::|.|   :.:...|:|. |.:|.|:|.|||||||:    .||| |    
  Fly   293 LKLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTY---- 353

  Fly   242 RYLQLGIVSFGDDKCQS---PGVYTYVPNYIRWIRYVMQS 278
             |...|:||||...|..   |||||.|..|:.||:..::|
  Fly   354 -YFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTIES 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 88/269 (33%)
Tryp_SPc 45..273 CDD:238113 88/269 (33%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 88/269 (33%)
Tryp_SPc 128..389 CDD:238113 89/271 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.