DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG3505

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:278 Identity:93/278 - (33%)
Similarity:138/278 - (49%) Gaps:52/278 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LIPS-CG-VSYESNVATRIVRGKEAMLKSAPFMAYLYYS----SEIH-CGGTIISSRYILTAAHC 86
            |:|| || |.::.:..|      :..::..|::|.:.|:    .:|| |||.:||.||:||||||
  Fly    95 LLPSDCGKVRWQRSNDT------DTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHC 153

  Fly    87 MR-------PYLKVRLGEHDITRNPDCQ------GGSCSPPAEEF---DIVLATKYKRFDRFLAN 135
            :.       ....|||||.|.:.|||||      ...|:||.::.   :::....|.|.||...|
  Fly   154 VAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQIN 218

  Fly   136 DIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEF--QAFGWGQTETNHSANVLQTTVLT----- 193
            ||||::|:...:.|..:|||||......|..:.:.  :..|| |..::........|:.:     
  Fly   219 DIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGW-QASSSQRMRKGYVTISSIEECQ 282

  Fly   194 -RYDNRHCRSVLSMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQ 257
             :|.::..|      |..::|| |...|..|.|::||||:...| ||   ||..|:||||...|.
  Fly   283 RKYASQQLR------IQASKLC-GLTNSQECYGNAGGPLMLFKN-DG---YLLGGLVSFGPVPCP 336

  Fly   258 S---PGVYTYVPNYIRWI 272
            :   |.|||.|.:||.||
  Fly   337 NPDWPDVYTRVASYIDWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 84/259 (32%)
Tryp_SPc 45..273 CDD:238113 86/260 (33%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 87/262 (33%)
Tryp_SPc 111..354 CDD:214473 85/260 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.