DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and snk

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:325 Identity:97/325 - (29%)
Similarity:133/325 - (40%) Gaps:73/325 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TSIYIC--------MCVCLVLQEQVAANFLIPSCGVSYESNVATR-------------------- 44
            |.|.||        :|..|..:..:|.......|   .|.|.|.|                    
  Fly   122 TRIDICTHRNNVPVICCPLADKHVLAQRISATKC---QEYNAAARRLHLTDTGRTFSGKQCVPSV 183

  Fly    45 --IVRGKEAMLKSAPFMAYLYYSS---------EIHCGGTIISSRYILTAAHC----MRPYLKVR 94
              ||.|........|.||.|.::.         :..|||.::|..|:||||||    .:|...||
  Fly   184 PLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVR 248

  Fly    95 LGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRFLANDIALLKLSRNIRFNVHIQPICLIL 159
            ||...:......|     ...:...|||..||:....:  :|||||||:|.::|:..::|.||..
  Fly   249 LGARQLNETSATQ-----QDIKILIIVLHPKYRSSAYY--HDIALLKLTRRVKFSEQVRPACLWQ 306

  Fly   160 NP-AAAPNVHEFQAFGWGQTE-TNHSANVLQTTVLTRYDNRHCRSV------LSMPITINQLCVG 216
            .| ...|.|   .|.|||:|| ....:|.|:...|.......|:.:      |...|...|.|.|
  Fly   307 LPELQIPTV---VAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAG 368

  Fly   217 F--QGSDTCSGDSGGPLVTKV-NYDGVWRYLQLGIVSFGDDKC---QSPGVYTYVPNYIRWIRYV 275
            :  .|.|||.||||||:...: .|:.|  ...:||.||| ..|   .:|||||.:.:|:.||..:
  Fly   369 YLPGGRDTCQGDSGGPIHALLPEYNCV--AFVVGITSFG-KFCAAPNAPGVYTRLYSYLDWIEKI 430

  Fly   276  275
              Fly   431  430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 84/276 (30%)
Tryp_SPc 45..273 CDD:238113 84/254 (33%)
snkNP_001097766.1 CLIP 93..139 CDD:197829 5/16 (31%)
Tryp_SPc 186..430 CDD:238113 85/256 (33%)
Tryp_SPc 186..427 CDD:214473 83/253 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437479
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.