DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG3916

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:298 Identity:79/298 - (26%)
Similarity:126/298 - (42%) Gaps:74/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CVCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSS----EIHCGGTII 75
            |:.|:|::.:|.       .|:..:...||| .|.:.:.::.||...|....    :..|||:|:
  Fly     8 CMLLILRQGLAD-------VVTSTTESPTRI-NGGQRVNETVPFQVSLQMQRRGRWQHFCGGSIV 64

  Fly    76 SSRYILTAAHCMRPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLAT---------------- 124
            |.:::|||||||.. :||                      |:..:|:.|                
  Fly    65 SGQHVLTAAHCMEK-MKV----------------------EDVSVVVGTLNWKAGGLRHRLVTKH 106

  Fly   125 ---KYKRFDRFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHE---FQAFGWGQTETNHS 183
               :|....|.: |||||:|::.  .|.:....|..|| ...:..:.|   .:..|||.|..:.|
  Fly   107 VHPQYSMNPRII-NDIALVKVTP--PFRLERSDISTIL-IGGSDRIGEKVPVRLTGWGSTSPSTS 167

  Fly   184 A----NVLQTTVLTRYDNRHCRSVLSMPITINQLC-VGFQGSDTCSGDSGGPLVTKVNYDGVWRY 243
            :    :.||........|..|.. ....:|.|::| :..||...|.|||||||:.    .|...:
  Fly   168 SATLPDQLQALNYRTISNEDCNQ-KGFRVTRNEICALAVQGQGACVGDSGGPLIR----PGKQPH 227

  Fly   244 LQLGIVSFGDDKCQS--PGVYTYVPNYIRWIRYVMQSN 279
            | :||||:|...|..  |.|||.|.:::.:|..|:..:
  Fly   228 L-VGIVSYGSSTCAQGRPDVYTRVSSFLPYISQVINQD 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 71/260 (27%)
Tryp_SPc 45..273 CDD:238113 70/260 (27%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 71/260 (27%)
Tryp_SPc 31..260 CDD:238113 71/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.