DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG17404

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:271 Identity:70/271 - (25%)
Similarity:108/271 - (39%) Gaps:77/271 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIVRGKEAML-KSAPFMAYLYY---SSEIH-CGGTIISSRYILTAAHCMRPYLKVRLGEHDITRN 103
            |||.|.:... :..|:...|.|   ..::| |||:||:...|||||||                 
  Fly    34 RIVGGADIPPGEHVPYQVSLQYRTRGGQMHFCGGSIIAPNRILTAAHC----------------- 81

  Fly   104 PDCQGGSCS------------PPAEEFDIVLATKYKRFDRFLANDIALLKLSRNIRFNVHIQPIC 156
              |||.:.|            .......::..:.:.::...:.:|:|:|.:...::.|       
  Fly    82 --CQGLNASRMSVVAGIRGLNEKGSRSQVLSYSIHPKYQELVTSDLAVLSIKPPLKLN------- 137

  Fly   157 LILNPAAAPNVHEFQA------------FGWGQ--------TETNHSANVLQTTVLTRYDNRHCR 201
               |...:...:..|.            .|||.        .:..:..||||........|..||
  Fly   138 ---NSTISAIEYRSQGKDFVGGGVPVTLTGWGLRLPVPFPFLDNVNYPNVLQRMSYHTISNSECR 199

  Fly   202 SVLSMPITINQLCV--GFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQ---SPGV 261
            :.....:|..::|.  .|:|:  ||||||||||.: :.:|:   .|:||||:|...|.   ||.|
  Fly   200 NAGMESVTDTEICARGPFRGA--CSGDSGGPLVME-SKNGL---QQVGIVSYGLVVCGLYISPDV 258

  Fly   262 YTYVPNYIRWI 272
            ||.|..:..||
  Fly   259 YTRVSTFSDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 68/269 (25%)
Tryp_SPc 45..273 CDD:238113 69/270 (26%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 68/269 (25%)
Tryp_SPc 35..269 CDD:238113 67/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.