DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG13318

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:267 Identity:75/267 - (28%)
Similarity:122/267 - (45%) Gaps:43/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHC-GGTIISSRYILTAAHCM----RPYLK 92
            ||..:.....:......:|...:.|:.|.|..:::::. ||.:|:::::|||||.:    ..|.|
  Fly   151 CGRRFPPPPGSTTAAPGQASFGAYPWQAALLTTADVYLGGGALITAQHVLTAAHKVYNLGLTYFK 215

  Fly    93 VRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKY--KRFD-RFLANDIALLKLSRNIRFNVH--I 152
            |||||.|        ..|.|.|....|:.::..|  ..|: ..|.||:|:||||..:.....  :
  Fly   216 VRLGEWD--------AASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTV 272

  Fly   153 QPICLILNPAAAPNVHEFQAFGWGQTE---TNHSANVLQTTVLTRYDNRHCRSVLS--------- 205
            ..:||   |..:.........|||:.:   |.....:.:...:....|.:|::.|.         
  Fly   273 GTVCL---PTTSFVGQRCWVAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFV 334

  Fly   206 -MPITINQLCVGFQ-GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQS--PGVYTYVP 266
             .|.:.  :|.|.: |.|.|:||.|.|||...|  ||| |: :|:|::|....|:  ||||..|.
  Fly   335 LSPTSF--ICAGGEAGKDACTGDGGSPLVCTSN--GVW-YV-VGLVAWGIGCAQAGVPGVYVNVG 393

  Fly   267 NYIRWIR 273
            .|:.||:
  Fly   394 TYLPWIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 71/253 (28%)
Tryp_SPc 45..273 CDD:238113 72/253 (28%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 73/249 (29%)
Tryp_SPc 169..399 CDD:214473 71/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.