DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and MP1

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:275 Identity:93/275 - (33%)
Similarity:139/275 - (50%) Gaps:37/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSE-----IHCGGTIISSRYILTAAHCMR 88
            :.|:||    .|...|:|.|.|...:..|:||.:.|:..     .||||::|:.||:||||||:.
  Fly   126 MAPNCG----ENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVS 186

  Fly    89 ------PYLKVRLGEHDITRNPDCQGG-----SCSPPAEEFDI---VLATKYKRFDRFLANDIAL 139
                  ....|||||.|.:.||||..|     .|:.|..::.:   :...:|....|...|||||
  Fly   187 AIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIAL 251

  Fly   140 LKLSRNIRFNVHIQPICLILNPAAAPNV---HEFQAFGWGQTETNHSANV-----LQTTVLTRYD 196
            |:|...::::..|.|:||....:...|:   .:....|||:||||.::|:     |.|...:..:
  Fly   252 LRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECN 316

  Fly   197 NRHCRSVLSMPITINQLCV-GFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQS-- 258
            .|:  :.....:|..|:|. |.:|.|:|.|||||||:.:...:|...|...|:||:|...|..  
  Fly   317 QRY--ATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKG 379

  Fly   259 -PGVYTYVPNYIRWI 272
             |||||.|..|:.||
  Fly   380 WPGVYTRVEAYLNWI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 87/258 (34%)
Tryp_SPc 45..273 CDD:238113 88/259 (34%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 87/258 (34%)
Tryp_SPc 138..397 CDD:238113 88/259 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463548
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.