DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG18223

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:238 Identity:60/238 - (25%)
Similarity:95/238 - (39%) Gaps:57/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CGGTIISSRYILTAAHCMRPYLKVRLGEH----------DITRNPDCQGGSCSPPAEEFDIVLAT 124
            |||.|||..||||:|||.....|:   .|          ...|....:|.|.:...::..:.   
  Fly    79 CGGVIISRTYILTSAHCAMDKRKI---VHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVP--- 137

  Fly   125 KYKRFDRFLANDIALLKLSRNIRFNVHIQPICLILN-PAAAPNVH-EFQAFGWGQTETNHSANVL 187
              .:|..|..|:|||:.|::.:..:   .|:..::| |.|.|... .:...|||:.   .....|
  Fly   138 --DKFTVFNTNNIALMMLAKKLPLD---NPLVGVINLPTADPEPGLNYTVLGWGRI---FKGGPL 194

  Fly   188 QTTVLTRYDNRHC------RSVLSMPITI---NQLCVG----FQGSDTCSGDSGGPLVTKVNYDG 239
            .:.:|      |.      |.:....:.|   ..:|.|    ....:.|:||:|.||:......|
  Fly   195 ASDIL------HIDVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFG 253

  Fly   240 VWRYLQLGIVSFGDDKCQS---PGVYTYVPNYIRWIRYVMQSN 279
            |..| ::|        |.|   |.:||.|..::.||..:|.:|
  Fly   254 VVSY-RVG--------CGSKTLPSIYTNVYMHMDWINGIMNNN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 56/229 (24%)
Tryp_SPc 45..273 CDD:238113 57/230 (25%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 58/232 (25%)
Tryp_SPc 60..280 CDD:214473 56/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437322
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.