DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG6865

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:293 Identity:94/293 - (32%)
Similarity:137/293 - (46%) Gaps:42/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IYICMCVCLV--LQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCGG 72
            :::...:.||  .|.|:|  |....|.|.     ..:||.|.||.....|:|..|.......|||
  Fly     5 VFVVAVLSLVKCAQSQIA--FSNQPCSVR-----NPKIVGGSEAERNEMPYMVSLMRRGGHFCGG 62

  Fly    73 TIISSRYILTAAHC--------MRP-YLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKR 128
            ||||.|:||||.||        |:| .::..:|.|.|...  ..|....|.|...|......:.:
  Fly    63 TIISERWILTAGHCICNGLQQFMKPAQIQGVVGLHSIREY--LNGIGNGPDALRVDFKNIVPHPQ 125

  Fly   129 FD-RFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEF-QAFGWGQTETNHSAN----VL 187
            :| ..:.:|||||:|.:.|||:.||||.|:...........|: ...|||.|..|.:.|    ||
  Fly   126 YDCNDVKHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDRSDVL 190

  Fly   188 QTTVLTRYDNRHC-RSVLSM----PITINQLCVGFQGS--DTCSGDSGGPLVTKVNYDGVWRYLQ 245
            :...:..::|..| ||..|:    .|...|||.|::..  |:|..||||||::|.::       .
  Fly   191 RKATVKIWNNEACERSYRSLGKSNTIGETQLCAGYENGQIDSCWADSGGPLMSKEHH-------L 248

  Fly   246 LGIVSFGDDKCQS--PGVYTYVPNYIRWIRYVM 276
            :|:||.|....:.  ||:||.|..|:.|::.|:
  Fly   249 VGVVSTGIGCARPGLPGIYTRVSKYVSWMQKVI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 84/251 (33%)
Tryp_SPc 45..273 CDD:238113 85/251 (34%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 84/250 (34%)
Tryp_SPc 35..280 CDD:238113 85/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.