DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG7542

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:275 Identity:85/275 - (30%)
Similarity:129/275 - (46%) Gaps:34/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MCVCLVLQEQVAANFLIPSC-GVSYESNVATRIVRGKEAMLKSAPFMAYLYYSS---EIHCGGTI 74
            :.||::         |:.|| .|...::|...|..|:.|.:...|:.|.|..|.   ...||||:
  Fly     4 LLVCVL---------LVGSCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTL 59

  Fly    75 ISSRYILTAAHCM--RPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRFLANDI 137
            ||..:|:||||||  ...:.|.||..:|  ..:.:.|......|:..|::.:.|  ....:.|||
  Fly    60 ISHYWIITAAHCMDGAESVTVYLGAINI--GDESEEGQERIMVEKSGIIVHSNY--MASTVVNDI 120

  Fly   138 ALLKLSRNIRFNVHIQPICL--ILNPAAAPNVHEFQAF--GWG-QTETNHSAN-VLQTTVLTRYD 196
            :|::|...:.|...|:...|  .|| ...|.....:||  ||| :::.:.|.: ||:...:....
  Fly   121 SLIRLPAFVGFTDRIRAASLPRRLN-GQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMP 184

  Fly   197 NRHCRSVLSMPITINQLCVG-FQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDK-CQ-- 257
            :..||...|..::...:|:. ..|..||.||||||||.|   .|...|| :|..|||... ||  
  Fly   185 HSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYK---QGNSSYL-IGSTSFGTSMGCQVG 245

  Fly   258 SPGVYTYVPNYIRWI 272
            .|.|:|.:.:|:.||
  Fly   246 FPAVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 76/242 (31%)
Tryp_SPc 45..273 CDD:238113 78/243 (32%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 78/243 (32%)
Tryp_SPc 27..260 CDD:214473 76/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436336
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.