DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG4914

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:271 Identity:96/271 - (35%)
Similarity:134/271 - (49%) Gaps:40/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AANFLIPSCGVSY-ESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAAHCMR 88
            |.|...|:|.... |.|..:|||.|....:...|:||.|.|.:..:||||:|:.||:||||||::
  Fly   107 AQNQTSPTCSCRCGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVK 171

  Fly    89 PY----LKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRFLANDIALLKLSRNIRFN 149
            .:    :||..||||...:.:       .|...|.:...::...|..| .||||||:|:..:...
  Fly   172 GFMWFMIKVTFGEHDRCNDKE-------RPETRFVLRAFSQKFSFSNF-DNDIALLRLNDRVPIT 228

  Fly   150 VHIQPICLILNPAAAPNVHEFQ---------AFGWGQ-TETNHSANVLQTTVLTRYDNRHC---R 201
            ..|:||||       |.|.:.|         |.|||. .|....:.:||...:...||..|   .
  Fly   229 SFIRPICL-------PRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQT 286

  Fly   202 SVLSMPITINQLCVGFQ---GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDD--KCQSPGV 261
            :.....||.|.:|.|:.   |.|:|.|||||||| ::..|.. |:.|:||||:|:.  :...|||
  Fly   287 NYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLV-RLRPDDK-RFEQIGIVSWGNGCARPNYPGV 349

  Fly   262 YTYVPNYIRWI 272
            ||.|..|:.||
  Fly   350 YTRVTKYLDWI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 88/249 (35%)
Tryp_SPc 45..273 CDD:238113 89/250 (36%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 88/249 (35%)
Tryp_SPc 128..363 CDD:238113 89/250 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.