DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG3088

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:241 Identity:61/241 - (25%)
Similarity:100/241 - (41%) Gaps:38/241 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IVRGKEAMLKSAPFMAYLYY-SSEIHCGGTIISSRYILTAAHCMRPYLKVRLGEHDITRNPDCQG 108
            |..|..|....||::..:.: .|.|.|.||||...:|||:|.|:       .|...:|    ...
  Fly    29 ITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTWILTSAQCL-------TGSSGVT----IYF 82

  Fly   109 GSCSPPAEEFDIVLAT-KYKRFDRFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQA 172
            |:......:|.:.:.| :|...::.|    ||:::.| :.|:..:..:.|   |:.......::.
  Fly    83 GATRLSQAQFTVTVGTSEYVTGNQHL----ALVRVPR-VGFSNRVNRVAL---PSLRNRSQRYEN 139

  Fly   173 F-----GWGQTE-TNHSANVLQTTVLTRYDNRHCRSVLSMPITINQ-LCVGF-QGSDTCSGDSGG 229
            :     |||.|. :|...:.||...|....|..|.:........:| ||... .|..||.||:|.
  Fly   140 WWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGS 204

  Fly   230 PLVTKVNYDGVWRYLQLGIVSF-GDDKCQ--SPGVYTYVPNYIRWI 272
            ||:||.:...|      ||.:| ..:.|.  .|..:..:.:.:.||
  Fly   205 PLITKQDSTVV------GISAFVASNGCTLGLPAGFARITSALDWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 59/239 (25%)
Tryp_SPc 45..273 CDD:238113 61/241 (25%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 61/241 (25%)
Tryp_SPc 29..244 CDD:214473 59/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.