DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG33460

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:293 Identity:83/293 - (28%)
Similarity:130/293 - (44%) Gaps:61/293 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSISLASTSIYICMCVCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYS 65
            ::|||.::.:.:      :..:.|:||:|...||:..|           |......|:.|.|:..
  Fly     5 LTISLLASYMLV------IYSDSVSANYLYEQCGLMRE-----------EFSTSLGPWTALLHTD 52

  Fly    66 SEIHCGGTIISSRYILTAAHCMRP-YLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRF 129
            ..|.|.||:|:..:|||||.|:|| .:||||||  ..|.|       :...|:..:.....|:.|
  Fly    53 GSIFCAGTLITDVFILTAASCIRPNAVKVRLGE--FGRYP-------NELPEDHLVHYFLMYRLF 108

  Fly   130 -DRFLANDIALLKLSRNIRFNVHIQPICLILNPAAAP-NVHEFQAFGWGQTETNHSANVLQTTVL 192
             :..|||:|.||||::.::...:|.|:|::|||.... :...|....|.:     .:||..|..|
  Fly   109 NNESLANNIGLLKLTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGNAWME-----DSNVSLTKEL 168

  Fly   193 TRYDNRHCRSVLSMPITI-------------NQLCVGFQGS-DTCSGDSGGPLVTKVNYDGVWRY 243
                         .||.|             .|.|.|.||: .:|.|.:|..|:....|...:|:
  Fly   169 -------------RPIVIQSKPKMCTNLDLYTQFCAGHQGNLRSCDGLTGSALIQNSRYMNKYRH 220

  Fly   244 LQLGIVSFGDDKCQSPGVYTYVPNYIRWIRYVM 276
            :|.||.:..|..|:....||.|..:..||:.|:
  Fly   221 IQFGIATVNDMDCEESQGYTDVLKFYWWIQDVV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 70/244 (29%)
Tryp_SPc 45..273 CDD:238113 71/244 (29%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 71/234 (30%)
Tryp_SPc 44..249 CDD:214473 69/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463292
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.