DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG33465

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:277 Identity:83/277 - (29%)
Similarity:130/277 - (46%) Gaps:27/277 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISLASTSIYICMCVCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSE 67
            :|||...:.:|         |..|..|...|   ::...:..| .......::||:||.:|.:::
  Fly     5 LSLALIGLVLC---------QGLAQLLDKKC---HDPKTSENI-NFNHGATETAPWMASIYKNNQ 56

  Fly    68 IHCGGTIISSRYILTAAHCMR--PYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRF- 129
            ..|.||::...::||||.|:.  ..|.|..|.::..|:     .|.....|::.:.:|.::..| 
  Fly    57 FICDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRD-----ASQFFNNEQYGVAVALQHSNFR 116

  Fly   130 DRFLANDIALLKLSRNIRFNVHIQPICLILNPA--AAPNVHEFQAFGWGQTETNHSANVLQTTVL 192
            .....|||.||:|...:....||:|||:||:..  :|| ...|:.|||.|..|..|:.|.||..|
  Fly   117 PNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAP-FERFEGFGWQQQGTEASSQVRQTVYL 180

  Fly   193 TRYDNRHC-RSVLSMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRY-LQLGIVSFGDDK 255
            ::.....| |:...:||...|.|.|.:....|..:||.||.....| ||... :|:|:||:|.:.
  Fly   181 SQKKPFECHRNGQLLPINEGQFCAGNRDRSFCRSNSGSPLTADFTY-GVKNITVQVGLVSYGSEL 244

  Fly   256 CQSPGVYTYVPNYIRWI 272
            |....|||.|..:..||
  Fly   245 CSPTSVYTDVVAFKDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 73/234 (31%)
Tryp_SPc 45..273 CDD:238113 75/235 (32%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 73/223 (33%)
Tryp_SPc 46..261 CDD:214473 71/221 (32%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463397
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.