DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG10469

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:290 Identity:90/290 - (31%)
Similarity:132/290 - (45%) Gaps:62/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYL--YYSSEIH----CGGTIIS 76
            ::||..:...|.:    |..:...:.||:.|..|..|..|:...|  |:.....    |||||:|
  Fly     1 MILQLVLIVQFSL----VFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILS 61

  Fly    77 SRYILTAAHCMRP------YLKVRLGEHDITRNPDCQGGSCSPPAEEFD---IVLATKY----KR 128
            :|:|:|||||::.      .:.:.:|:                 .:.||   ||:...|    |:
  Fly    62 NRWIITAAHCLQDPKSNLWKVLIHVGK-----------------VKSFDDKEIVVNRSYTIVHKK 109

  Fly   129 FDR-FLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAF--GWGQTETNHSANVLQTT 190
            ||| .:.|||||:||.:.:.||.:|||..|   |:|.......:|.  |||.|.....:.|||..
  Fly   110 FDRKTVTNDIALIKLPKKLTFNKYIQPAKL---PSAKKTYTGRKAIISGWGLTTKQLPSQVLQYI 171

  Fly   191 VLTRYDNRHCR-------SVLSMPITINQ-LCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLG 247
            ......|:.|.       ...|..:..|. :|:..:....|.||||||:|..   ||. |.| :|
  Fly   172 RAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKKGLPCRGDSGGPMVLD---DGS-RTL-VG 231

  Fly   248 IVSFGDD---KCQSPGVYTYVPNYIRWIRY 274
            |||.|.|   |.:.|.|.|.|.:|::||:|
  Fly   232 IVSHGFDGECKLKLPDVSTRVSSYLKWIKY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 83/260 (32%)
Tryp_SPc 45..273 CDD:238113 83/260 (32%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 83/260 (32%)
Tryp_SPc 24..260 CDD:238113 83/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436468
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.