DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG6592

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:229 Identity:75/229 - (32%)
Similarity:111/229 - (48%) Gaps:37/229 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LYYSSEIHCGGTIISSRYILTAAHC--MRPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLAT 124
            ||:     |||::||.::::|||||  |.....|.||.::|....:........|:|.|.|....
  Fly   148 LYW-----CGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTW 207

  Fly   125 KYKRFDRFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVH-EFQAF--------GWGQTET 180
            ..||    |.:|||:::|...:.||..|.||.|       |..| |:::|        |||:..|
  Fly   208 NPKR----LKDDIAIVRLPHAVSFNERIHPIQL-------PKRHYEYRSFKNKLAIASGWGRYAT 261

  Fly   181 N-HS-ANVLQTTVLTRYDNRHCRSVLSMPITINQLCV-GFQGSDTCSGDSGGPLVTKVNYDGVWR 242
            . |: :|||:...|...|.|.|:|...:......:|. |.....||:||||||||.:..:..  :
  Fly   262 GVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNARSTCNGDSGGPLVLQRRHSK--K 324

  Fly   243 YLQLGIVSFGD----DKCQSPGVYTYVPNYIRWI 272
            .:.:||.|||.    |: ..|..:|.|.:|:.||
  Fly   325 RVLVGITSFGSIYGCDR-GYPAAFTKVASYLDWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 73/227 (32%)
Tryp_SPc 45..273 CDD:238113 75/229 (33%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 73/227 (32%)
Tryp_SPc 123..359 CDD:238113 75/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.