DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:275 Identity:69/275 - (25%)
Similarity:104/275 - (37%) Gaps:89/275 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ESNVATRIVRGKEAMLKSAPFMAYLYYSSE---IHCGGTIISSRYILTAAHCMRPYLKVRL---- 95
            ::::..||..|..|.....|::..|.:|..   ..|||:||.:.:::||.||......|.:    
  Fly    31 KASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHCTDGMESVTIYYGA 95

  Fly    96 -------GEHDITRNPDCQGGS------CSPPAEEFDIVLATKYKRFDRFLANDIALLKLSRNIR 147
                   ..|.:.|:...:.||      .:|..:.:.:|...:..|:|.               |
  Fly    96 LWRLQAQYTHWVGRSDFIEHGSGDISLIRTPHVDFWSLVNKVELPRYDD---------------R 145

  Fly   148 FNVHIQPICLILNPAAAPNVHEFQAF--GWGQTETNHSANVLQTTVLTRYDNRHCRSVLSMPITI 210
            :|                |...:.|.  |||:|.....        ::.|.|  |   :.:.|..
  Fly   146 YN----------------NYQGWWALVSGWGKTSDEGG--------VSEYLN--C---VDVQIGE 181

  Fly   211 NQLCVGFQGS--------------DTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDK-CQS-- 258
            |.:|..:.||              .|||||||||||.   :||   ..|:||||||... |.|  
  Fly   182 NSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPLVI---HDG---NRQVGIVSFGSSAGCLSNG 240

  Fly   259 PGVYTYVPNYIRWIR 273
            |.....|.:|:.|||
  Fly   241 PKGMVRVTSYLDWIR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 66/266 (25%)
Tryp_SPc 45..273 CDD:238113 66/266 (25%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 66/266 (25%)
Tryp_SPc 41..257 CDD:238113 67/265 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435610
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.