DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:258 Identity:75/258 - (29%)
Similarity:113/258 - (43%) Gaps:47/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SNVATRIVRGKEAMLKSAPFMAYLYYSS---EIHCGGTIISSRYILTAAHCMRPYLKVRLGEHDI 100
            :|:..||..||.|.....|:...|.::|   ...|||:||.:.::||||||......|.:     
  Fly    34 TNIEGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTI----- 93

  Fly   101 TRNPDCQGGSCSPPAEEFDIVLATKYKRFDRF----LANDIALLKLSRNIRFNVHIQPICLILNP 161
                 ..|.:....|:....|.|..:.:...:    |.|||:|:| :..:.|...|..:.|   |
  Fly    94 -----YYGATVRTSAQLVQTVSADNFVQHASYNSIVLRNDISLIK-TPTVAFTALINKVEL---P 149

  Fly   162 AAAPNVHEFQ-----AFGWGQTETNHS--ANVLQTTVLTRYDNRHCRSVL-SMPITINQLCVGFQ 218
            |.|.....:.     |.|||:|..:.:  ||.||..|........|::.. |:..|.|.:||...
  Fly   150 AIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNVICVATP 214

  Fly   219 GS-DTCSGDSGGPLV----TKVNYDGVWRYLQLGIVSF-GDDKCQS--PGVYTYVPNYIRWIR 273
            .. .||:||||||||    :|:          :|:.|| ....|:|  |..:|.|.:|:.||:
  Fly   215 NKVSTCNGDSGGPLVLVSDSKL----------IGVTSFVSSAGCESGAPAGFTRVTSYLDWIK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 72/250 (29%)
Tryp_SPc 45..273 CDD:238113 72/250 (29%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 72/250 (29%)
Tryp_SPc 40..269 CDD:238113 73/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436237
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.