DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:294 Identity:82/294 - (27%)
Similarity:124/294 - (42%) Gaps:70/294 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LVLQEQVAANFLIPSCGVSYES-------NVATRIVRGKEAMLKSAPFMAYLYYS----SEIHCG 71
            ::|...|||: ..|...:.:.|       ::..||..|..|.:...|:...|...    |...||
  Fly     5 IILALAVAAS-AFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAWCG 68

  Fly    72 GTIISSRYILTAAHC------MRPYLKVRLGEHDITRNPDCQGGSCSPPAE------EFDIVLAT 124
            |::|.|.::||||||      :..||                |.:....||      ..||::.:
  Fly    69 GSLIGSTWVLTAAHCTDGVQSVTVYL----------------GATVRTSAEITHTVSSSDIIIHS 117

  Fly   125 KYKRFDRFLANDIALLKL---SRNIRFNVHIQPICLILNPAAAPNVHEF-----QAFGWGQTETN 181
            .:...:  |.|||:|:|:   |.:.|       |..:..|:.:.:...|     .|.|||:|...
  Fly   118 GWNSAN--LRNDISLIKIPATSSSSR-------ISAVKLPSISNSYSTFVGDVAVASGWGRTSDT 173

  Fly   182 HS--ANVLQTTVLTRYDNRHCRSVL-SMPITINQLCVG-FQGSDTCSGDSGGPLVTKVNYDGVWR 242
            .|  |..||...||...|..|.... :..:|.:.|||. .....||:||||||||.|.:.:    
  Fly   174 SSGVATNLQYVDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSE---- 234

  Fly   243 YLQLGIVSFGDDK-CQS--PGVYTYVPNYIRWIR 273
              |:|:.|||... |:.  |..:|.|.:|:.||:
  Fly   235 --QIGLTSFGASAGCEKGYPAAFTRVTSYLDWIK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 74/258 (29%)
Tryp_SPc 45..273 CDD:238113 74/258 (29%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 74/258 (29%)
Tryp_SPc 38..268 CDD:238113 75/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436270
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.