DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and yip7

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:283 Identity:88/283 - (31%)
Similarity:131/283 - (46%) Gaps:47/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VCLVLQEQVAANFLIPSCG-VSYESNVAT-----RIVRGKEAMLKSAPFMAYLYYSSEI---HCG 71
            |.|||....|:..|:|:.. |.....|:|     ||..||:|:....|:...|.:||..   .||
  Fly     5 VVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCG 69

  Fly    72 GTIISSRYILTAAHCMRPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRFLA-- 134
            |:||.:.::||||||......|.:          ..|.:.....|...:|.::|:::.:.:||  
  Fly    70 GSIIGNEWVLTAAHCTDGAASVTI----------YYGATVRTSPEFTQVVSSSKFRQHESYLALT 124

  Fly   135 --NDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQ-----AFGWGQTETNHSA--NVLQTT 190
              |||:|::.| ::.|:..:..|.|   ||.:.:...::     |.|||.|....:|  ..||..
  Fly   125 IRNDISLIQTS-SVSFSATVNKISL---PAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYV 185

  Fly   191 VLTRYDNRHCRSVL-SMPITINQLCVGFQG-SDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGD 253
            .||...|..|:... |:.:|...|||.... :.||.|||||||.    .|||    .:|..|||.
  Fly   186 DLTIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLA----LDGV----LIGATSFGS 242

  Fly   254 -DKCQS--PGVYTYVPNYIRWIR 273
             |.|:|  |..:|.:..|..||:
  Fly   243 ADGCESGAPAAFTRITYYRDWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 76/246 (31%)
Tryp_SPc 45..273 CDD:238113 76/246 (31%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 76/246 (31%)
Tryp_SPc 40..267 CDD:238113 77/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.