DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG10477

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:252 Identity:73/252 - (28%)
Similarity:111/252 - (44%) Gaps:47/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIVRGKEAMLKSAPFMAYLYYSSEI---HCGGTIISSRYILTAAHCMRPYLKVRLGEHDITRNPD 105
            ||..|.:|.....|:...|.:.|..   .|||:||::.::||||||.:       |...:|   .
  Fly    39 RITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTK-------GASSVT---I 93

  Fly   106 CQGGSCSPPAEEFDIVLATKYKRFDRF----LANDIALLKLSRNIRFNVHIQPICLILNPAAAPN 166
            ..|.:....|:....|.::|:.:...:    |.|||:|:| :.::.|.|.|..|.|   ||.|.:
  Fly    94 YYGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIK-TPSVTFTVSINKIAL---PAIASS 154

  Fly   167 VHEFQ-----AFGWGQTETNHSA-----NVLQTTVLTRYDNRHCRSVL-SMPITINQLCV-GFQG 219
            ...:.     |.|||:|..:..|     ...|..|:|   |..|:... |..:|...:|| ....
  Fly   155 YSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVIT---NAVCQKTFGSSVVTSGVICVESINK 216

  Fly   220 SDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDK-CQ--SPGVYTYVPNYIRWIR 273
            ..||.|||||||......        :|:.||...| |:  :|..:|.|.:|:.||:
  Fly   217 KSTCQGDSGGPLALNNRL--------IGVTSFVSSKGCEKNAPAGFTRVTSYLDWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 71/249 (29%)
Tryp_SPc 45..273 CDD:238113 71/249 (29%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 71/249 (29%)
Tryp_SPc 40..267 CDD:238113 72/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436204
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.