DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG15873

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:284 Identity:69/284 - (24%)
Similarity:113/284 - (39%) Gaps:78/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LIPSCGVSYESNVATR---IVRGKEAMLKSAPFMAYLYYSSEIH-CGGTIISSRYILTAAHCMRP 89
            ::.|.|...:||..:|   .:|.|.          |:.:..:.| |.|.::|||.:||||||:..
  Fly    34 MLISGGYKPKSNRLSRHVVSIRTKN----------YVRHRGDNHFCSGVLVSSRAVLTAAHCLTD 88

  Fly    90 YLK-------VRLGEHDITRNPDCQGGSCSPPAEEFD------IVLATKYKRFDRFLANDIALLK 141
            ..|       :|:....|||         ....:|.|      :|:..:|:|:.:   ||:|:|:
  Fly    89 RYKASMNPRGIRVVFGHITR---------LAVYDESDFRSVDRLVVHPEYERYKK---NDLAILR 141

  Fly   142 LSRNIRFNVH-IQPI-------------CLILNPAAAPNVHEFQAFGWGQTETN--HSANVLQTT 190
            ||..::.:.| :.|:             |:.|              ||||...:  :|..::...
  Fly   142 LSERVQSSNHDVLPLLMRKTANVTYGDTCITL--------------GWGQIYQHGPYSNELVYLD 192

  Fly   191 VLTRYDNRHCRSVLSMPITINQLCVGFQG-SDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDD 254
            |:.|..:. |:.........:.:|....| |..|:||.||||:.|    |....|..|.:.....
  Fly   193 VILRPPSL-CQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLCK----GALFGLIGGHMGCAGG 252

  Fly   255 KCQSPGVYTYVPNYIRWIRYVMQS 278
            |......:.|   |..||...:||
  Fly   253 KAMKFLSFLY---YKDWILLTIQS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 61/261 (23%)
Tryp_SPc 45..273 CDD:238113 61/258 (24%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 62/254 (24%)
Tryp_SPc 59..250 CDD:238113 55/221 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436732
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.