DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and tpr

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:270 Identity:80/270 - (29%)
Similarity:126/270 - (46%) Gaps:61/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAAHCMRPYLK----V 93
            ||:   :|:..|||.|:|..:...|::|.|.|....:|..::::.:::|||:||:..:.|    |
  Fly   118 CGI---ANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISV 179

  Fly    94 RLGEHD--------ITRNPDCQGGSCSPPAEEFDIVLATKY--KRFDRFLANDIALLKLSRNIRF 148
            ||.|||        |.|             :..:::...||  :.:|    ||||::||...:.|
  Fly   180 RLLEHDRKMSHMQKIDR-------------KVAEVITHPKYNARNYD----NDIAIIKLDEPVEF 227

  Fly   149 NVHIQPICLILNPAAAPNVHEFQAFGWGQTE----TNHSANVLQTTVL-------TRYDNRHCRS 202
            |..:.|:|: ..|..:.........|||..:    |:.:...:|..:|       :||.|:    
  Fly   228 NEVLHPVCM-PTPGRSFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNK---- 287

  Fly   203 VLSMPITINQLCVGFQ--GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDD--KCQSPGVYT 263
                 ||.|.||.|:.  |.|:|.|||||||  .:...|...:...|:||:|:.  |...||||.
  Fly   288 -----ITDNMLCGGYDEGGKDSCQGDSGGPL--HIVASGTREHQIAGVVSWGEGCAKAGYPGVYA 345

  Fly   264 YVPNYIRWIR 273
            .|..|..||:
  Fly   346 RVNRYGTWIK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 75/256 (29%)
Tryp_SPc 45..273 CDD:238113 75/256 (29%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 75/256 (29%)
Tryp_SPc 127..356 CDD:238113 76/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.