DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG30283

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:281 Identity:94/281 - (33%)
Similarity:150/281 - (53%) Gaps:31/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LASTSIYICMCV----CLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYS 65
            :.:|.|::.:.:    .:|:....:.:||...||....|..  :|:.|..|.:.|||:||.:...
  Fly     1 MKNTKIFVVVVLLAASSVVVLGSESGSFLEHPCGTVPISQF--KILGGHNAPVASAPWMAMVMGE 63

  Fly    66 SEIHCGGTIISSRYILTAAHCM-RPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDI---VLATKY 126
            ...|||||:|::|::||:|||: ...||||||.  :.|..:         |::|.:   .:.|.|
  Fly    64 GGFHCGGTLITNRFVLTSAHCIANGELKVRLGV--LEREAE---------AQKFAVDAMFVHTDY 117

  Fly   127 KRFDRFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHE----FQAFGWGQTETNHSANVL 187
             .||:   :|:|||:|::.:.::.:|.||||:|:| ...|:.|    |:.:|||:||:..|:.:|
  Fly   118 -YFDQ---HDLALLRLAKRVHYSDNISPICLLLDP-LVKNIDEHIVKFRTYGWGKTESRSSSRML 177

  Fly   188 QTTVLTRYDNRHC-RSVLSMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSF 251
            |.|.|.......| :......|..|.:|.....::||:|||||||...|.||.|....|.|:.||
  Fly   178 QKTSLFNLHRSECAKQYPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSF 242

  Fly   252 GDDKCQSPGVYTYVPNYIRWI 272
            |...|....|:|.|..::.||
  Fly   243 GHADCSKATVFTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 84/236 (36%)
Tryp_SPc 45..273 CDD:238113 86/237 (36%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 84/236 (36%)
Tryp_SPc 43..266 CDD:238113 86/237 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.850

Return to query results.
Submit another query.