DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG1773

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:287 Identity:98/287 - (34%)
Similarity:138/287 - (48%) Gaps:52/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LVLQEQVAANFLIPSCGVSYESN------VATRIVRGKEAMLKSAPFMAYLYYSSEI---HCGGT 73
            |:..||:...    .|||.  ||      :..||..|:::.|.|.|:||:|:.|.:|   .|||:
  Fly    35 LLAYEQLTQQ----DCGVL--SNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGS 93

  Fly    74 IISSRYILTAAHCMR-----PYLKVRLGEHDITRNPDCQGGS----CSPPAEEFDIVLATKYKRF 129
            ::|..::||||||.:     ..::|.|||.||:...||...:    |:.|.|||.|.....::.|
  Fly    94 LLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEF 158

  Fly   130 DRFLAN-DIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAF-----------GWGQTETNH 182
            :.|... ||||:||::.:.|..||:||||       |...|..||           |||:||:..
  Fly   159 NLFYPGYDIALIKLNKKVVFKDHIRPICL-------PLTDELLAFTLQLGQSYMAVGWGRTESRR 216

  Fly   183 SANVLQTTVLTRYDNRHCRSVLSMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLG 247
            .||   :|:....:...|........    ||......|||:|||||||:.|....|..|.:|.|
  Fly   217 FAN---STMEVHINTEKCTDGRDTSF----LCANGDYVDTCTGDSGGPLIWKTTLFGKARTVQFG 274

  Fly   248 IVSFGDDKCQS--PGVYTYVPNYIRWI 272
            :||.|...|.:  ...|..||.|:.||
  Fly   275 VVSTGSQNCGAGQKAYYMDVPTYVPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 88/253 (35%)
Tryp_SPc 45..273 CDD:238113 89/254 (35%)
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 88/253 (35%)
Tryp_SPc 62..301 CDD:238113 87/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.