DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG8738

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:309 Identity:84/309 - (27%)
Similarity:131/309 - (42%) Gaps:51/309 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CMCV--CLVLQEQV----------AANFLIPSCGVSYESNVATRI--VRGKEAMLKSAPFM-AYL 62
            |..|  |..|.:|:          ..:||:..||.|....:..::  ....|::....|:| |.:
  Fly   156 CRVVEECCPLGDQIEEGRNPIQRNVKDFLLKGCGYSNPKGLYYQLDGYNNGESVFAEFPWMVALM 220

  Fly    63 YYSSEIHCGGTIISSRYILTAAHCM----RPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLA 123
            .......||||:|..:.:||:||.:    ...|.||.|:.|:....:..      |.:...|...
  Fly   221 DMEGNFVCGGTLIHPQLVLTSAHNVFNRSEDSLLVRAGDWDLNSQTELH------PYQMRAISEL 279

  Fly   124 TKYKRFDRF-LANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVH-EFQ-----AFGWG--QTE 179
            .:::.|:.. |.|||||:.|.|..:...||||||  |.|...|.:. |.:     |.|||  .:.
  Fly   280 HRHENFNNLTLYNDIALVVLERPFQVAPHIQPIC--LPPPETPQMEAELRSASCLATGWGLRYST 342

  Fly   180 TNHSANVLQTTVLTRYDNRHCRSVLSMPITINQ-------LCV-GFQGSDTCSGDSGGPLVTKV- 235
            :....|:|:...|...|:..|:.:|...:...:       .|. |.:|.|||.||.|.||...: 
  Fly   343 SRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCTLP 407

  Fly   236 -NYDGVWRYLQLGIVSFGDDKCQS--PGVYTYVPNYIRWIRYVMQSNGY 281
             ..|   ||..:|:||:|.:..:.  |..||.|.....||...:..:|:
  Fly   408 GQKD---RYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQVTKSGF 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 71/255 (28%)
Tryp_SPc 45..273 CDD:238113 72/255 (28%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 73/250 (29%)
Tryp_SPc 207..444 CDD:214473 71/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.