DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and Jon44E

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:296 Identity:81/296 - (27%)
Similarity:122/296 - (41%) Gaps:75/296 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CMCVC---LVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIH-CGGT 73
            |:.|.   :|..|...|   :|...:.....:..||..|..|.....|::..|.::...: |||:
  Fly     9 CLAVASAGVVPSESARA---VPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGS 70

  Fly    74 IISSRYILTAAHCMRP--YLKVRLG--------------EHDITRNPDCQGGSCSPPAEEFDIVL 122
            ||...::||||||...  ::.:..|              ..|:.::||                 
  Fly    71 IIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQYTHWVSRSDMIQHPD----------------- 118

  Fly   123 ATKYKRFDRFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHE---------FQAFGWGQT 178
                  ::.||.|||||:::.       |:. ...::|....|:.::         ..|.|||.|
  Fly   119 ------WNDFLNNDIALIRIP-------HVD-FWSLVNKVELPSYNDRYNSYSGWWAVASGWGLT 169

  Fly   179 ETNHS-ANVLQTTVLTRYDNRHCRSVL-SMPITINQLCVGFQ-GSDTCSGDSGGPLVTKVNYDGV 240
            :.|.. :|.|....:...||..||:.. |..||.|.:|:... |..:||||||||||...|...|
  Fly   170 DNNSGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNNRIV 234

  Fly   241 WRYLQLGIVSFGD-DKCQS--PGVYTYVPNYIRWIR 273
                  ||||||. :.|.:  |..:|.|..|:.|||
  Fly   235 ------GIVSFGSGEGCTAGRPAGFTRVTGYLDWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 72/259 (28%)
Tryp_SPc 45..273 CDD:238113 72/259 (28%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 72/259 (28%)
Tryp_SPc 41..266 CDD:238113 74/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435676
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.