DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and scaf

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:280 Identity:67/280 - (23%)
Similarity:108/280 - (38%) Gaps:59/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NFLIP----SCGVSYESNVATRI--VRGKEAMLKSAPFMAYLYYSSE--IHCGGTIISSRYILTA 83
            |::.|    ..||....|..|:.  |:..:|.....|:.|.:...|.  :.|||.||..:::|::
  Fly   399 NYVDPWPVNLAGVCATRNKRTKPTGVKDLDANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSS 463

  Fly    84 AHCMRPY----LKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFD-------RFLANDI 137
            |.|:...    ::|:.||.::        ||.:.|. .|.:   |..|..|       ...::|:
  Fly   464 ASCVNGLPVTDIRVKAGEWEL--------GSTNEPL-PFQL---TGVKTVDVHPDYDPSTNSHDL 516

  Fly   138 ALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAF--GWG-QTETNHSANVLQTTVLTRYDNR- 198
            |:::|.|.:.|..||||||:   ....|...| |.|  ||| |..:.|....|.....|....| 
  Fly   517 AIIRLERRLEFASHIQPICI---SDEDPKDSE-QCFTSGWGKQALSIHEEGALMHVTDTLPQARS 577

  Fly   199 HCRSVLSMPITINQLCVGFQGSDTCSGDSGGPLV----TKVNYDGVWRYLQLGIVSFGDDKCQSP 259
            .|.:..|...:..:.       |:|..|.|..|.    :.|...|::.         |::.|...
  Fly   578 ECSADSSSVCSATKF-------DSCQFDVGSALACGSGSSVRLKGIFA---------GENSCGEG 626

  Fly   260 GVYTYVPNYIRWIRYVMQSN 279
            ....:....|:||......|
  Fly   627 QTVRFAKPDIKWINTAFAEN 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 58/250 (23%)
Tryp_SPc 45..273 CDD:238113 59/250 (24%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 53/210 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435505
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.