DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG4793

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:287 Identity:87/287 - (30%)
Similarity:122/287 - (42%) Gaps:42/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VLQEQVAA-NFLIPS-CGVSYESNVATRIVRGKEAMLK-SAPFMAYLYYS-SEIHC-GGTIISSR 78
            :||..|.| |..:|: ||......|...|...::...| ..|:|..|..| |.:.. ||::|:..
  Fly    70 ILQYPVQADNQPLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRD 134

  Fly    79 YILTAA----HCMRPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRFL---AND 136
            .:||::    .....||.||.||.|..        |.:......|:.:....:..:..:   ||:
  Fly   135 VVLTSSTKTLEVPEKYLIVRAGEWDFE--------SITEERAHEDVAIRKIVRHTNLSVENGANN 191

  Fly   137 IALLKLSRNIRFNVHIQPICLILNPAAAPN---VH-EFQAFGWGQTET--NHSANVLQTTVLTRY 195
            .|||.|:|.::.:.||..|||     ..||   :| .....|||:...  |...|:|:...|...
  Fly   192 AALLFLARPLKLDHHIGLICL-----PPPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLV 251

  Fly   196 DNRHCRSVLSMP-----ITINQL-CVGFQ-GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGD 253
            |...|::.|..|     |..|.| |.|.: |.|||.||.|.||...:..|.. ||..||||:||.
  Fly   252 DRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPN-RYELLGIVNFGF 315

  Fly   254 DKCQS--PGVYTYVPNYIRWIRYVMQS 278
            . |..  |..||.|.....||...:|:
  Fly   316 G-CGGPLPAAYTDVSQIRSWIDNCIQA 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 75/252 (30%)
Tryp_SPc 45..273 CDD:238113 76/252 (30%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 76/246 (31%)
Tryp_SPc 105..335 CDD:214473 74/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.