DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG4650

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:271 Identity:77/271 - (28%)
Similarity:127/271 - (46%) Gaps:33/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FLIPSCGVS-YESNVATRIVRGKEAMLKSAPFMAYLYYSSEIH-CGGTIISSRYILTAAHCMR-- 88
            ||:|..|.| |.......:..||.|...|:|:||||:.|..:: ||||:|:.:.:||||||.|  
  Fly    13 FLLPVPGSSQYLDGRCGLLTNGKIANNISSPWMAYLHTSELLYVCGGTVITEKLVLTAAHCTRAS 77

  Fly    89 PYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRFL---------ANDIALLKLSR 144
            ..|..|:||...|              ::.:..:.::|:....|:         |||||:|.|:.
  Fly    78 EQLVARIGEFIGT--------------DDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLAT 128

  Fly   145 NIRFNVHIQPICLI---LNPAAAPNVHEFQAFGWGQTETNHSANVLQTTVLTRYDNRHCRSVLSM 206
            :|.|:..|:|||::   :......|:.......||.....:.::..:.|.:.|.....|.::...
  Fly   129 DIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGT 193

  Fly   207 PITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQSPGVYTYVPNYIRW 271
            .|..:|.|.|...|..|:.|...||...:.:..:.||:.:||.: .:.||:...|||.|.::..:
  Fly   194 AILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIAT-TNQKCKRASVYTDVLSHTDF 257

  Fly   272 IRYVMQS--NG 280
            |..|.:.  ||
  Fly   258 ILSVWRQYRNG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 67/242 (28%)
Tryp_SPc 45..273 CDD:238113 67/242 (28%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 67/239 (28%)
Tryp_SPc 33..258 CDD:304450 67/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463307
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.