DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG9377

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:245 Identity:62/245 - (25%)
Similarity:110/245 - (44%) Gaps:31/245 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAAHCMR--PYLKVRL--GEHDITRNPDCQGG 109
            :||.....|::..:|.|....|.|.:|:...::|.|||::  ...||||  ||.|.....:.|  
  Fly   105 QEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQ-- 167

  Fly   110 SCSPPAEEFDIVLATKYKRFDRF-LANDIALLKLSRNIRFNV--HIQPICLILNPAAAPNVHEFQ 171
                |.::..:|....:..:.:. ||::||:|.:.:...|.:  ::||||| ..|....|..:..
  Fly   168 ----PHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICL-PPPRIMYNYSQCY 227

  Fly   172 AFGWGQTETNHSANVLQTTVLTRYDNRHCRSVLSMPI-------TINQLCVGFQGSDTCSGD--- 226
            ..||.:::...:|.:.:...|.......||:.|.:.:       ..:.||.|....|...||   
  Fly   228 VSGWQRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVCGDVDM 292

  Fly   227 SGGPLVTKVN-YDGVWRYLQLGIVSFGDDKCQSP---GVYTYVPNYIRWI 272
            :..||:..:: :|.  |:...|::: ...:|..|   |:||.|..|.:||
  Fly   293 TAVPLMCPLSGHDD--RFHLAGLLT-RTARCDGPQLLGIYTNVKLYRQWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 60/243 (25%)
Tryp_SPc 45..273 CDD:238113 62/245 (25%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 62/245 (25%)
Tryp_SPc 105..339 CDD:214473 60/243 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435472
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.