DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:269 Identity:89/269 - (33%)
Similarity:127/269 - (47%) Gaps:50/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGVSYESNVAT----RIVRGKEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAAHCMR----- 88
            ||   ..|..|    |||.|..|.....|::|.|:.|.:..|||::|::.:|||||||:.     
  Fly   387 CG---NKNPVTPDQERIVGGINASPHEFPWIAVLFKSGKQFCGGSLITNSHILTAAHCVARMTSW 448

  Fly    89 --PYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIV-LATKYKRFDRF-------LANDIALLKLS 143
              ..|...||:::|              ..:|::. ::.:.||..|.       |.||:|:|.||
  Fly   449 DVAALTAHLGDYNI--------------GTDFEVQHVSRRIKRLVRHKGFEFSTLHNDVAILTLS 499

  Fly   144 RNIRFNVHIQPICLILNPAAAPNVHEFQ---AFGWGQ-TETNHSANVLQTTVLTRYDNRHCRSVL 204
            ..:.|...||||||..:|:.....:..|   ..|||. .|.....::||...:..:.|..|....
  Fly   500 EPVPFTREIQPICLPTSPSQQSRSYSGQVATVAGWGSLRENGPQPSILQKVDIPIWTNAECARKY 564

  Fly   205 SMP----ITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSF--GDDKCQSPGVYT 263
            ...    |..:.:|.|....|:||||||||:|  :|..|  ||.|:||||:  |..|.|.|||||
  Fly   565 GRAAPGGIIESMICAGQAAKDSCSGDSGGPMV--INDGG--RYTQVGIVSWGIGCGKGQYPGVYT 625

  Fly   264 YVPNYIRWI 272
            .|.:.:.||
  Fly   626 RVTSLLPWI 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 83/252 (33%)
Tryp_SPc 45..273 CDD:238113 84/253 (33%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 83/252 (33%)
Tryp_SPc 400..637 CDD:238113 84/253 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.