DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG5390

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:295 Identity:75/295 - (25%)
Similarity:107/295 - (36%) Gaps:94/295 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGVSYESNVATRIVR--GKEAMLKSAPFM-AYLYYSSEIH---CGGTIISSRYILTAAHCMRPYL 91
            ||....:.|..:|..  .:||.....|:| |.|.....::   |||.:|:...:||||||:.   
  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVH--- 196

  Fly    92 KVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRF-DRF--------------LANDIALLK 141
                         :.|..|....|.|:|....|:.:|. ||:              |.||:|::.
  Fly   197 -------------NKQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVML 248

  Fly   142 LSRNIRFNVHIQPICLILNPAAAPNV---HEFQ---AFGWGQTETNHSANVLQTTVLTRYDNRHC 200
            |........:||.:||       |||   .:|.   |.|||:.:......  ...:|.:.|    
  Fly   249 LESPFTLQENIQTVCL-------PNVGDKFDFDRCYATGWGKNKFGKDGE--YQVILKKVD---- 300

  Fly   201 RSVLSMPITINQLCV----------------------GFQGSDTCSGDSGGPLVTKV----NYDG 239
                 ||:...|.|.                      |.:..|||.||.|.|||..:    |   
  Fly   301 -----MPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKN--- 357

  Fly   240 VWRYLQLGIVSF--GDDKCQSPGVYTYVPNYIRWI 272
              |:...|||::  |..:...||||..|.....||
  Fly   358 --RFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 70/282 (25%)
Tryp_SPc 45..273 CDD:238113 72/283 (25%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 71/277 (26%)
Tryp_SPc 153..390 CDD:214473 69/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.