DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and Jon25Bii

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster


Alignment Length:263 Identity:73/263 - (27%)
Similarity:112/263 - (42%) Gaps:52/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SYESNVATRIVRGKEAMLKSAPFMAYLYYSSEI---HCGGTIISSRYILTAAHCMRPYLKVRLGE 97
            |...::..||..|..|.....|::..|.:||:.   .|||:||...:::|||||..       |.
  Fly    34 SGSGSIEGRITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTH-------GA 91

  Fly    98 HDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRF----LANDIALLKLSRNIRFNVHIQPICLI 158
            |.:|   ...|......|:....|.:..:::...:    |.|||:|:.       ..|:. ...:
  Fly    92 HSVT---IYYGALWRLQAQYTHTVGSGHFRQHSDYNTNNLNNDISLIN-------TPHVD-FWHL 145

  Fly   159 LNPAAAPNVHEFQ---------AFGWGQ----TETNHSANVLQTTVLTRYDNRHCRSVLSMP-IT 209
            :|....|:.:|..         |.|||:    ...:...|.:.:.::||.:   |.||.... ||
  Fly   146 INKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDE---CSSVYGTDVIT 207

  Fly   210 INQLCVGFQ-GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSF-GDDKCQS--PGVYTYVPNYIR 270
            .|.:|.... |..||:||||||||.   :|   |...:|:.|| ....|.|  |..:|.|.:|:.
  Fly   208 DNVICTSTPGGKSTCAGDSGGPLVL---HD---RSKLVGVTSFVAASGCTSGLPDGFTRVTSYLD 266

  Fly   271 WIR 273
            |||
  Fly   267 WIR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 69/252 (27%)
Tryp_SPc 45..273 CDD:238113 69/252 (27%)
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 69/252 (27%)
Tryp_SPc 43..271 CDD:238113 71/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435709
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.