DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:304 Identity:75/304 - (24%)
Similarity:113/304 - (37%) Gaps:91/304 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSISLASTSIYICMCVCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYS 65
            :::::||.|.:         .|:|....| |..     :.:..||..|..|....||:...|.:|
  Fly     8 LALAVASASAF---------DEKVFVKDL-PKA-----TKIEGRITNGYAAPEGKAPYTVGLGFS 57

  Fly    66 SEIHCGGTIISSRYILTAAHCMRPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFD 130
            ....|||:||:..::|||.||:                     |..:.....|.....|. .:|.
  Fly    58 GGWWCGGSIIAHDWVLTAEHCI---------------------GDAASVIVYFGATWRTN-AQFT 100

  Fly   131 RFLAN---------DIALLKL---------------SRNIRFNVHIQPICLILNPAAAPNVHEFQ 171
            ..:.|         ||||:::               |.|.|:|                |.:|:.
  Fly   101 HTVGNGNFIKHSNADIALIRIPHVDFWHMVNKVELPSYNDRYN----------------NYNEWW 149

  Fly   172 AF--GWGQT-ETNHSANVLQTTVLTRYDNRHCRSVLSMPITINQLCV-GFQGSDTCSGDSGGPLV 232
            |.  |||.| :.:...:.||...|....|..|..... .:..|.:|. ...|...|.||||||||
  Fly   150 AVACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWTYG-SVGDNVICTRTVDGKSICGGDSGGPLV 213

  Fly   233 TKVNYDGVWRYLQLGIVSF-GDDKCQS--PGVYTYVPNYIRWIR 273
            |   :||   ...:|:.:| ..:.|||  |..:..|..::.|||
  Fly   214 T---HDG---SKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 65/258 (25%)
Tryp_SPc 45..273 CDD:238113 65/258 (25%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 65/258 (25%)
Tryp_SPc 37..253 CDD:238113 67/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.