DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG3355

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:260 Identity:89/260 - (34%)
Similarity:121/260 - (46%) Gaps:43/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGVSYESNVATRIVRGKEAMLKSAPFMAYLY---YSSEIHCGGTIISSRYILTAAHCM---RPYL 91
            ||.   .|| .|||.|::......|:.|.|.   :...:.|||::|:.||:||||||:   |..:
  Fly    68 CGT---PNV-NRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQI 128

  Fly    92 KVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFD-RFLANDIALLKLSRNIRFNVHIQPI 155
            .:||.:.|         .|...|.....:|..|.:..:| ..:.||:|||||...:....:::|:
  Fly   129 TIRLLQID---------RSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPV 184

  Fly   156 CLILNPAAAPNVHEFQ-----AFGWGQ-TETNHSANVLQTTVLTRYDNRHCRSV-LSMPITINQL 213
            ||   |.|.   |.|.     ..|||. .|...::|.||...:....|..||.. ....|....|
  Fly   185 CL---PEAN---HNFDGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVML 243

  Fly   214 CVGF---QGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQ--SPGVYTYVPNYIRWIR 273
            |.|.   .|.|.|.|||||||:  || :|  ||...|:||||....|  :||||..|..::.|||
  Fly   244 CAGLVQQGGKDACQGDSGGPLI--VN-EG--RYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIR 303

  Fly   274  273
              Fly   304  303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 82/246 (33%)
Tryp_SPc 45..273 CDD:238113 82/246 (33%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 82/246 (33%)
Tryp_SPc 76..305 CDD:238113 84/248 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.