DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG18557

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:241 Identity:60/241 - (24%)
Similarity:95/241 - (39%) Gaps:72/241 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GTIISSRYILTAAHCMRPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIV--------LATK--- 125
            ||:::...::||||.|.          |.|.|             :|.|:        ||.|   
  Fly   112 GTLVTENIVITAAHLML----------DKTIN-------------DFGIIGGAWDLKQLAGKTIQ 153

  Fly   126 ---------YKRFDRFL-ANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAF--GWGQT 178
                     :..|::.. ||:|||:.|..:......|.|||.   |.:..:....:..  |||:.
  Fly   154 WRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICW---PTSGVSFDRERCLVAGWGRP 215

  Fly   179 E---TNHS--ANVLQTTVLTRYDNRHCRSVL-------SMPITINQLCVGFQ-GSDTCSGDSGGP 230
            :   .|:|  ...:...:::|.|   |.|:|       |..:....||.|.: |.|.|.||.|.|
  Fly   216 DFLAKNYSYKQKKIDLPIVSRSD---CESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSP 277

  Fly   231 LVTKV-NYDGVWRYLQLGIVSFGDDKC---QSPGVYTYVPNYIRWI 272
            |:..: .:..:  |..:|||:.| ..|   ..|.:||.:.:...||
  Fly   278 LMCPIPGHPAI--YELVGIVNSG-FSCGLENVPALYTNISHMRPWI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 58/239 (24%)
Tryp_SPc 45..273 CDD:238113 60/241 (25%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 60/241 (25%)
Tryp_SPc 90..320 CDD:214473 58/239 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.