DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and psh

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:249 Identity:76/249 - (30%)
Similarity:119/249 - (47%) Gaps:45/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PFMA---YLYYSSEIHCGGTIISSRYILTAAHCMRPYLK----VRLGEHDITRNPDCQGGSCSPP 114
            |.||   |:.:.::..|||::|:||::||||||:.....    ||||..:| .|||         
  Fly   156 PHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNI-ENPD--------- 210

  Fly   115 AEEFDIVLATKYKRFDRFLA---NDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAFGWG 176
             ..:..::....|...:::.   ||||:|:|.|::....:|:|.||..:....|:..:|...|||
  Fly   211 -HSYQDIVIRSVKIHPQYVGNKYNDIAILELERDVVETDNIRPACLHTDATDPPSNSKFFVAGWG 274

  Fly   177 --QTETNHSANVLQTTVLTRYDNRHCR-SVLSMPITINQLCVGFQGS-----------DTCSGDS 227
              ...|...:.:|....|.......|. |....|.:|..|..|...|           |.|.|||
  Fly   275 VLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDS 339

  Fly   228 GGPLVTKVNY-DGVWRYLQLGIVS--FGDDKCQ--SPGVYTYVPNYIRWIRYVM 276
            ||||:.::|. ||:  |..:|::|  ||   |.  :||:||.|.:|:.:|..::
  Fly   340 GGPLIHELNVEDGM--YTIMGVISSGFG---CATVTPGLYTRVSSYLDFIEGIV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 75/243 (31%)
Tryp_SPc 45..273 CDD:238113 75/244 (31%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 75/243 (31%)
Tryp_SPc 144..387 CDD:238113 76/246 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.