DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG9673

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:275 Identity:76/275 - (27%)
Similarity:109/275 - (39%) Gaps:74/275 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAAHCMRPY--------- 90
            :|.|::...||:.|::......|:.|.:.|:....|.|.|||:.:|||||||:...         
  Fly    19 LSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDAST 83

  Fly    91 LKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRFLANDIALLKLSRNIRFNVHIQPI 155
            |.||||    |.| ...|||.   .....:::...|..|    .:|||:|:|...:.|:..||.|
  Fly    84 LAVRLG----TIN-QYAGGSI---VNVKSVIIHPSYGNF----LHDIAILELDETLVFSDRIQDI 136

  Fly   156 CLILNP-----------AAAPNVHEFQAFGWG----------QTETNHSANVLQTTVLT-----R 194
            .|   |           |..||.......|||          |.:.|:  |.|..::..     .
  Fly   137 AL---PPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANY--NTLSRSLCEWEAGYG 196

  Fly   195 YDNRHCRSVLSMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQS- 258
            |::..|.|             ..:|...|.||:|..:   ::.|.|.|    |:.||....|.| 
  Fly   197 YESVVCLS-------------RAEGEGICRGDAGAAV---IDDDKVLR----GLTSFNFGPCGSK 241

  Fly   259 -PGVYTYVPNYIRWI 272
             |.|.|.|..|:.||
  Fly   242 YPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 72/264 (27%)
Tryp_SPc 45..273 CDD:238113 73/265 (28%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 72/264 (27%)
Tryp_SPc 29..259 CDD:238113 73/265 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.