DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and sphe

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:244 Identity:62/244 - (25%)
Similarity:103/244 - (42%) Gaps:37/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIVRGKEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAAHCMRPYLKVRLGEHDITRNPDCQG 108
            ||:.|::|...:..|.|.|...:...|||:|:|...|||.|||:.     |.|:........|:.
  Fly    25 RIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVH-----RDGKLIDASRLACRV 84

  Fly   109 GSCSPPAEEFDIVLATKYKRFDRF-LANDIALLKLSRNIRFNVHIQPICLILNPAAAP-NVHEFQ 171
            ||.:..|....:.:.:.....|.: |.|::|::.||..:.:...|..|.|:.:..|.| ...|..
  Fly    85 GSTNQYAGGKIVNVESVAVHPDYYNLNNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVI 149

  Fly   172 AFGWGQT-ETNHSANVLQ--------TTVLTRYDNRHCRSVLSMPITINQLCVGFQGSD-TCSGD 226
            ..|||:| :..:|..:.|        .|.|..|.:...:|          .|:..:..: ||.||
  Fly   150 VAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQS----------FCLAHELKEGTCHGD 204

  Fly   227 SGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQS--PGVYTYVPNYIRWIR 273
            .||        ..::....:|:.:|....|.|  |.|:..:.:|..||:
  Fly   205 GGG--------GAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 60/241 (25%)
Tryp_SPc 45..273 CDD:238113 60/241 (25%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 56/227 (25%)
Tryp_SPc 42..244 CDD:214473 54/224 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436534
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.