DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG33127

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:253 Identity:68/253 - (26%)
Similarity:113/253 - (44%) Gaps:45/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IVRGKEAM-LKSAPFMAYLYYSSEIH---CGGTIISSRYILTAAHCMRPYLKVRLGEHDITRNPD 105
            |:.|.:.. :.:.|::..|..:...:   ||.:||..|::||||||:.   ::|....|....|.
  Fly    41 IIDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVD---ELRTFNGDAVGTPV 102

  Fly   106 CQG---GSCSPPAEEFDIVLATKYKRFDRFLAND-IALLKLSRNIRFNVHIQPICLILNPAAAPN 166
            ..|   .|....|:...:..|:.::.|:....:| ||||.:|.:..:|..:|.|.|       |:
  Fly   103 YAGIINRSNVTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIAL-------PD 160

  Fly   167 VHE------FQAFGWGQTET--NHSANVLQTTVLTRYDNRHCRSVL--SMPITINQLCVGFQGSD 221
            :::      ..|:|||.|:.  :..:..||.......::..|:.:|  ..|:|..|:|...:   
  Fly   161 INDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCSQVK--- 222

  Fly   222 TCSGDSGGPLV-------TKVNYDGVWRYLQLGIVSFGDDKCQSPGVYTYVPNYIRWI 272
            ||.||.|.||:       .::...|.|.|:..|..:       .|.|||.||.||.||
  Fly   223 TCYGDGGTPLIYWPITGPAELVGLGSWSYMPCGYAN-------RPTVYTSVPPYIGWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 66/251 (26%)
Tryp_SPc 45..273 CDD:238113 68/253 (27%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 68/253 (27%)
Tryp_SPc 41..273 CDD:214473 66/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.