DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and sphinx1

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:289 Identity:68/289 - (23%)
Similarity:121/289 - (41%) Gaps:78/289 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QVAANFLIPSCGVSY--ESNVATRIVRGKEAMLKSAPFMAYLYY----SSEIHCG-GTIISSRYI 80
            ::....|:.|..||.  ::.::.||..|..|...:..::..:.|    :|.::.| |||||:::|
  Fly     2 KLVVTLLVLSLTVSVGEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWI 66

  Fly    81 LTAAHCMR-PYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRF-LAND--IALLK 141
            ||....:: .|::|.|......|.              |||:..  ||...|| ..||  |||:|
  Fly    67 LTVKTVLKYSYIEVHLASRRSYRG--------------FDIIRI--YKENFRFHYDNDHVIALVK 115

  Fly   142 L---------------SRNIRFNVHIQPICLILNPAAAPNVHEFQAFGWGQTETNHS-----ANV 186
            .               :.:.||..::..:.::.              |:| ||..|:     ...
  Fly   116 CPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVC--------------GYG-TEKRHAKLPEWMRC 165

  Fly   187 LQTTVLTRYDNRHCRSVLSMPITINQLCV---GFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGI 248
            ::..|:   :|..|....: |:...::|.   ||:|  .|.||.||.:|| :..:..:    :||
  Fly   166 IEVEVM---NNTECAKYYT-PLKWYEMCTSGEGFKG--VCEGDIGGAVVT-MGPNPTF----IGI 219

  Fly   249 VSFGDDKCQ--SPGVYTYVPNYIRWIRYV 275
            :....:.|.  .|.|:..|.::|:||:.|
  Fly   220 IWLMPENCSIGYPSVHIRVSDHIKWIKRV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 61/261 (23%)
Tryp_SPc 45..273 CDD:238113 61/261 (23%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 61/261 (23%)
Tryp_SPc 26..248 CDD:304450 62/263 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436402
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.