DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG18420

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:288 Identity:100/288 - (34%)
Similarity:160/288 - (55%) Gaps:28/288 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISLASTSIYICMCVCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSS- 66
            :.:...||.:.:.|..:|.   :..||...||......:..|||.||.|:..|:|:||:|:.|| 
  Fly     4 VVIGMASILLLLTVFPLLG---STQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSN 65

  Fly    67 EIHCGGTIISSRYILTAAHCMRP--YLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRF 129
            :..||||:||.|.:||||||..|  .:.|||||:    |...:|     ..||..:....:::.:
  Fly    66 QFICGGTLISRRLVLTAAHCFIPNTTIVVRLGEY----NRKLKG-----YREEHQVNRTFQHRFY 121

  Fly   130 D-RFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAF---GWGQTETNHSANVLQTT 190
            | ...|||||||:|..|:.:..:|:|||::.:.:...::...:..   |||:||:.|.::.|:|.
  Fly   122 DPNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTL 186

  Fly   191 VLTRYDNRHCR--SVLSMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGD 253
            .::|..::.|.  ||||     ||.|.|...|:.|.||:|||:...|.|...:|::|:|| :..:
  Fly   187 DISRQPSKMCAFGSVLS-----NQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGI-AITN 245

  Fly   254 DKCQSPGVYTYVPNYIRWIRYV-MQSNG 280
            .:||.|.|:|.|.::|.:||.: :..||
  Fly   246 KRCQRPSVFTDVMSHIEFIRRIFLTQNG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 88/236 (37%)
Tryp_SPc 45..273 CDD:238113 87/236 (37%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 88/236 (37%)
Tryp_SPc 43..267 CDD:238113 89/238 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463304
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.