DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG18636

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:294 Identity:93/294 - (31%)
Similarity:158/294 - (53%) Gaps:22/294 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSISLASTSIYICMCVCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYS 65
            |..:|.....::.:.:...|.....:.||.|:||:..:|..|.||:.|..|...|:|:|.:|:.:
  Fly     1 MHTALIGVPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHST 65

  Fly    66 SEIH-CGGTIISSRYILTAAHCM--RPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYK 127
            :::. |||::|:.:.:||||||.  ..:|..||||::.||:.:|.|..|: ..||..:....|:|
  Fly    66 TDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCN-FREEHMVDAGFKHK 129

  Fly   128 RFD-RFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQ----------AFGWGQTETN 181
            .:| ...|||||:|:||:::.:..:|:|||::.:       |.::          |.|||:|:..
  Fly   130 LYDPNTHANDIAILRLSKSVVYRDNIRPICVVWD-------HRWRHYLDKIDLLTATGWGKTQME 187

  Fly   182 HSANVLQTTVLTRYDNRHCRSVLSMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQL 246
            ..::.|||..:.|.....|...:...|..||.|.|...|:.|:|||||||...:.:....|::|:
  Fly   188 SDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQV 252

  Fly   247 GIVSFGDDKCQSPGVYTYVPNYIRWIRYVMQSNG 280
            ||.|:.:..||...|:|.|.::..:|..|.:..|
  Fly   253 GIASYTNRNCQKASVFTDVLSHAEFILRVWRMYG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 80/241 (33%)
Tryp_SPc 45..273 CDD:238113 79/241 (33%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 80/241 (33%)
Tryp_SPc 45..278 CDD:238113 79/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463295
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.690

Return to query results.
Submit another query.