DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG33225

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:279 Identity:96/279 - (34%)
Similarity:154/279 - (55%) Gaps:15/279 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ICMCVCLVLQEQVAANFLIPS-CGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCGGTII 75
            |.:...|||..::.::.|:.: ||.:...:...|:|.|.:|...:.|:|..:...:.:.|.|::|
  Fly    23 IVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGSLI 87

  Fly    76 SSRYILTAAHCMRPYLK-VRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRF--DRFLANDI 137
            :..::||:|.|:....| |.|||:|  ||  |....|:...:..||.....:.:|  :.....||
  Fly    88 TRLFVLTSASCLLSLPKQVILGEYD--RN--CTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDI 148

  Fly   138 ALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAFGWGQTETNHSANVLQTTVLTRYDNRHCRS 202
            |||:|::.:..:.:::||||.::.....:|..|.|.|||.||.|..:.:|||..|::.:.::|:.
  Fly   149 ALLRLAKKVSISDYVRPICLSVDRQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSKINRKYCKG 213

  Fly   203 VLSMPITINQLCVGFQGSDTCSGDSGGP--LVTKVNYDGVW----RYLQLGIVSFGDDKCQSPGV 261
            .|...|..:|||||....||||||:|||  |..|::.||.|    |...:||||:|...|...||
  Fly   214 RLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSGIGV 278

  Fly   262 YTYVPNYIRWI-RYVMQSN 279
            ||.|.:|:.|| |.:.:||
  Fly   279 YTNVEHYMDWIVRTINKSN 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 84/236 (36%)
Tryp_SPc 45..273 CDD:238113 85/237 (36%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 84/236 (36%)
Tryp_SPc 57..292 CDD:238113 85/238 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.