DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG33459

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:280 Identity:97/280 - (34%)
Similarity:140/280 - (50%) Gaps:34/280 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VCLVLQEQVAANFLI--------PSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCGG 72
            :..:|...:.||.|:        |:||   :.....||..|.:|.|.|.|:||:|:...:..|||
  Fly     4 ISYLLVSSIIANQLLYGLAVLLEPNCG---QIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGG 65

  Fly    73 TIISSRYILTAAHCMRP---YLKVRLGEHDITRNPDCQGGSCSPP--AEEFDIVLATKYKRFDRF 132
            ::|:|.::||||||:.|   .|.|||||:|.||..|    |.:|.  ..|:.:.....:..:...
  Fly    66 SLITSEFVLTAAHCVMPTPKNLTVRLGEYDWTRQMD----SINPKHRHREYMVTRIYTHPSYRSI 126

  Fly   133 LANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHE----------FQAFGWGQTETNHSANVL 187
            .|.|||||||::.:.:.|.|:||||:|    ..|.||          |...|||.|:|...:.||
  Fly   127 AAYDIALLKLNQTVEYTVAIRPICLVL----PENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVL 187

  Fly   188 QTTVLTRYDNRHCRSVLSMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFG 252
            |:..||:.|...|.......:....:|.|...|..|.||||.||..||.::..:.:.|:||||.|
  Fly   188 QSANLTQIDRGTCHDRYGHSVDHTHICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRG 252

  Fly   253 DDKCQSPGVYTYVPNYIRWI 272
            ...|....|:|.|.::..||
  Fly   253 PKNCDGVTVFTNVVSFTEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 88/242 (36%)
Tryp_SPc 45..273 CDD:238113 89/243 (37%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 88/242 (36%)
Tryp_SPc 38..272 CDD:238113 87/241 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.