DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG33458

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:256 Identity:84/256 - (32%)
Similarity:132/256 - (51%) Gaps:10/256 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAAHCMR---PYLKVR 94
            ||:   |....||..|:::.|...|::|||:.:|:..|||::::..::||||||.|   ..:.||
  Fly    29 CGI---SKYTYRITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDKNAKVLVR 90

  Fly    95 LGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRFLANDIALLKLSRNIRFNVHIQPICLIL 159
            |||:|.::..||....|:.|..|:.|:....:..:......||||.||:|.:.:...|:||||:|
  Fly    91 LGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHYYDIALAKLNRYVVYTDSIRPICLML 155

  Fly   160 NP---AAAPNVHEFQAFGWGQTETNHSANVLQTTVLTRYDNRHCRSVLSMPITINQLCVGFQGSD 221
            ||   .....:..|...|||.|..:..::.||.|.:.:.|...||......:....:|.|.....
  Fly   156 NPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQIDRFTCRYWFGYMVDRTHICAGESKHY 220

  Fly   222 TCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQSPGVYTYVPNYIRWI-RYVMQSNGY 281
            ...|||||||.:.|:|....|:.|.||||..........|:|.:.:|..|| |.::.::|:
  Fly   221 VGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFHGVSVFTNILSYSNWIHRTIITNSGH 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 77/233 (33%)
Tryp_SPc 45..273 CDD:238113 78/234 (33%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 77/233 (33%)
Tryp_SPc 38..274 CDD:238113 78/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.