DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG33461

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:266 Identity:85/266 - (31%)
Similarity:137/266 - (51%) Gaps:19/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FLIPSCGV----SYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAAHCMR 88
            ||..:|||    ||      :|:.|..|.|...|:||:|:..:...|.|::|:..::||:|||:.
  Fly    27 FLEENCGVVPRLSY------KIINGTPARLGRYPWMAFLHTPTYFLCAGSLINQWFVLTSAHCIE 85

  Fly    89 PYLKV--RLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFD-RFLANDIALLKLSRNIRFNV 150
            ..:::  ||||::...:.||:...|....:|:::.:..|::.:| :..:|||.:|:|.|.:.:..
  Fly    86 DDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTY 150

  Fly   151 HIQPICLILN---PAAAPNVHEFQAFGWGQTETN---HSANVLQTTVLTRYDNRHCRSVLSMPIT 209
            ||||||:..:   ......:..|:|.|||.|.|:   .|:.||....|.|.....|..:......
  Fly   151 HIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFL 215

  Fly   210 INQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQSPGVYTYVPNYIRWIRY 274
            ..|:|.|....:.|.||||||....|...|:.|::|:||.||..:.|....:.|.|..|.|||:.
  Fly   216 SGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKVSILTDVVRYGRWIKK 280

  Fly   275 VMQSNG 280
            |:...|
  Fly   281 VVDWYG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 74/236 (31%)
Tryp_SPc 45..273 CDD:238113 75/236 (32%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 74/236 (31%)
Tryp_SPc 42..281 CDD:238113 76/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463336
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.690

Return to query results.
Submit another query.